• Featured Product
  • KD/KO Validated

CoraLite® Plus 555-conjugated Glutamine Synthetase Polyclonal antibody

Glutamine Synthetase Polyclonal Antibody for FC (Intra)
Cat No. CL555-11037

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

GLUL, GS, Glutamate--ammonia ligase, GLNS, EC:6.3.1.2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-11037 targets Glutamine Synthetase in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1510

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight 40-42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
RRIDAB_3084524
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15104
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GLUL(Glutamine synthetase) also named GS and GLNS, belongs to the glutamine synthetase family. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts(PMID:18662667). Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD). Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Protocols

Product Specific Protocols
FC protocol for CL Plus 555 Glutamine Synthetase antibody CL555-11037Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...