• Featured Product
  • KD/KO Validated

GLUT1 Monoclonal antibody

GLUT1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 66290-1-Ig
Clone No.2A5A2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

SLC2A1, 2A5A2, GLUT-1, SLC2A1,GLUT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human rectal cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue, human placenta tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66290-1-Ig targets GLUT1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17108

Product name: Recombinant human SLC2A1,GLUT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 216-280 aa of BC121804

Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 1
Calculated Molecular Weight 492 aa, 54 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC121804
Gene Symbol GLUT1
Gene ID (NCBI) 6513
RRIDAB_2881673
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11166
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 1 (GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is a uniporter protein responsible for the transport of glucose in many cell types and across the blood-brain barrier.

What is the molecular weight of GLUT1? Is GLUT1 post-translationally modified?

There are two forms of GLUT1 transporter that differ in their molecular weight. The 45-kDa form is found in glial cells, while the 55-kDa form is present in the endothelial cells regulating glucose transport over the blood-brain and blood-tissue barriers (PMID: 9630522). N-glycosylation of asparagine at position 42 is the only known post-translation modification of GLUT1 (PMID: 3839598).

What is the subcellular localization of GLUT1?

Glucose transporters, including GLUT1, are multiple-pass integral membrane proteins. GLUT1 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes.

What molecules can be transported by GLUT1?

The main substrate of GLUT1 transport is glucose, but it can also transport galactose, mannose, glucosamine, and reduced ascorbate. 

What is the tissue expression pattern of GLUT1?

GLUT1 is expressed by many cell types but the highest levels are observed in erythrocytes and in the central nervous system (astrocytes). GLUT1 is responsible for glucose transfer across the blood-brain and blood-tissue barriers, including placental transport.


Protocols

Product Specific Protocols
FC protocol for GLUT1 antibody 66290-1-IgDownload protocol
IF protocol for GLUT1 antibody 66290-1-IgDownload protocol
IHC protocol for GLUT1 antibody 66290-1-IgDownload protocol
WB protocol for GLUT1 antibody 66290-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
humanWB

Cell Metab

Di-methylation of CD147-K234 Promotes the Progression of NSCLC by Enhancing Lactate Export.

Authors - Ke Wang
WB,IF

ACS Nano

Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy.

Authors - Mengshi Jiang
humanWB,IHC

ACS Nano

Choline Phosphate-Grafted Nanozymes as Universal Extracellular Vesicle Probes for Bladder Cancer Detection

Authors - Qiang Li
WB

Mol Cell

TCR activation directly stimulates PYGB-dependent glycogenolysis to fuel the early recall response in CD8+ memory T cells.

Authors - Huafeng Zhang
humanWB

Nat Commun

Fasting inhibits aerobic glycolysis and proliferation in colorectal cancer via the Fdft1-mediated AKT/mTOR/HIF1α pathway suppression.

Authors - Mei-Lin Weng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Hua (Verified Customer) (09-06-2023)

Works ok in WB. Signal is weak and background is not very clean.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela cells, mouse liver, and mouse brain (cortex)
GLUT1 Antibody Western Blot validation (1:1000 dilution) in Hela cells, mouse liver, and mouse brain (cortex) (Cat no:66290-1-Ig)
FH

Iru (Verified Customer) (04-23-2019)

This antibody works ok-ish, even though the protocol says use 1:1500 to 1:3000, I have to use 1:500 to see the bands.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Fallopian tube epithelial cells
Loading...
||
New chat

Able

正在加载,请稍候...