GLUT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81463-1-RR (same clone as 81463-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81463-1-RR (SLC2A1,GLUT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81463-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 81463-1-RR (same clone as 81463-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 81463-1-RR (GLUT1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81463-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 81463-1-RR (same clone as 81463-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 81463-1-RR (GLUT1 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81463-1-PBS in a different storage buffer formulation.

GLUT1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 81463-1-PBS

Clone No.6F14

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

SLC2A1, 6F14, GLUT-1, SLC2A1,GLUT1

---

Product Information

81463-1-PBS targets GLUT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16282

  Product name: Recombinant human SLC2A1,GLUT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 216-280 aa of BC121804

  Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 1
• Calculated Molecular Weight: 492 aa, 54 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC121804
• Gene Symbol: GLUT1
• Gene ID (NCBI): 6513
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11166
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780).