GLUT1 Recombinant monoclonal antibody, PBS Only

GLUT1 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 81463-1-PBS
Clone No.6F14

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

SLC2A1, 6F14, GLUT-1, SLC2A1,GLUT1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81463-1-PBS targets GLUT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16282

Product name: Recombinant human SLC2A1,GLUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 216-280 aa of BC121804

Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 1
Calculated Molecular Weight 492 aa, 54 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC121804
Gene Symbol GLUT1
Gene ID (NCBI) 6513
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11166
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780).

Loading...
||
New chat Able
正在加载,请稍候...