GLUT4 Monoclonal antibody

GLUT4 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66846-1-Ig
Clone No.3G7C9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

SLC2A4, 3G7C9, Glucose transporter GLUT 4, Glucose transporter type 4, insulin-responsive, GLUT 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat heart tissue, human heart tissue, C2C12 cells, human skeletal muscle tissue, rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue, mouse adipose tissue, pig heart tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skeletal muscle tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66846-1-Ig targets GLUT4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, zebrafish, hamster
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15390

Product name: Recombinant human GLUT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 228-292 aa of BC069615

Sequence: RYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAV

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 4
Calculated Molecular Weight 509 aa, 55 kDa
Observed Molecular Weight 48-50 kDa
GenBank Accession NumberBC069615
Gene Symbol GLUT4
Gene ID (NCBI) 6517
RRIDAB_2882186
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14672
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 4 (GLUT4), also known as solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4), is a transporter protein regulating glucose transport across cell membranes in an INS-dependent manner.

What is the molecular weight of GLUT4? Is GLUT4 post-translationally modified?

The molecular weight of GLUT4 transporter is 55 kDa. GLUT4 can be N-glycosylated, which is important for its stability and trafficking between the recycling compartment and plasma membrane (PMID: 21757715 and 22545627), and it can also be ubiquitinated and phosphorylated (PMID: 23665900).

What is the subcellular localization of GLUT4?

Glucose transporters, including GLUT4, are multiple-pass integral membrane proteins. GLUT4 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes. The localization of GLUT4 depends on stimulation with  INS - in basal conditions GLUT4 is retained intracellularly, while upon  INS stimulation it is translocated to the plasma membrane (PMID: 18570632).

What molecules can be transported by GLUT4?

Although the main substrate of GLUT4 transport is glucose, it can also transport glucosamine.

What is the tissue expression pattern of GLUT4?

GLUT4 is expressed in white and brown adipose tissue and in muscle and heart cells, where it is the main glucose transporter responsible for peripheral glucose uptake in response to INS.

Which cell lines can be used to study insulin-dependent GLUT4 protein translocation in glucose uptake assays?

Fat and muscle cells are primarily used in glucose uptake assays because they physiologically respond to  INS(PMID: 26646194). The most commonly used cell lines are 3T3-L1 cells (murine pre-adipose fibroblasts), L6 cells (rat myoblasts), and C2C12 cells (murine myoblasts).


Protocols

Product Specific Protocols
FC protocol for GLUT4 antibody 66846-1-IgDownload protocol
IF protocol for GLUT4 antibody 66846-1-IgDownload protocol
IHC protocol for GLUT4 antibody 66846-1-IgDownload protocol
WB protocol for GLUT4 antibody 66846-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Di-methylation of CD147-K234 Promotes the Progression of NSCLC by Enhancing Lactate Export.

Authors - Ke Wang
humanWB

Adv Sci (Weinh)

NAT10/ac4C/FOXP1 Promotes Malignant Progression and Facilitates Immunosuppression by Reprogramming Glycolytic Metabolism in Cervical Cancer

Authors - Xiaona Chen
mouseWB,IHC

J Pineal Res

Melatonin increases susceptibility to atrial fibrillation in obesity via Akt signaling impairment in response to lipid overload

Authors - Xinghua Qin
mouseWB

Int J Biol Macromol

Lycium barbarum polysaccharide mitigates high-fat-diet-induced skeletal muscle atrophy by promoting AMPK/PINK1/Parkin-mediated mitophagy

Authors - Yanru Ren
humanWB

Oncogene

Programmed death ligand 1 promotes lymph node metastasis and glucose metabolism in cervical cancer by activating integrin β4/SNAI1/SIRT3 signaling pathway.

Authors - Shaojia Wang
mouseWB

Oxid Med Cell Longev

Protective Effect of Jiang Tang Xiao Ke Granules against Skeletal Muscle IR via Activation of the AMPK/SIRT1/PGC-1α Signaling Pathway.

Authors - Ying Bai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (11-25-2024)

recognized a protein at the expected size

  • Applications: Western Blot
FH

Hua (Verified Customer) (09-07-2023)

Good antibody for WB. Signal is strong, and the background is clean. It seems not work with GLUT4 of mouse origin.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 or 1:2000
  • Cell Tissue Type: human muscle, human heart, mouse liver, heart, muscle, and brain.
GLUT4 Antibody Western Blot validation (1:1000 or 1:2000 dilution) in human muscle, human heart, mouse liver, heart, muscle, and brain. (Cat no:66846-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...