Tested Applications
| Positive WB detected in | Caco-2 cells, A549 cells, mouse kidney tissue, rat testis tissue | 
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below | 
| IHC | See 3 publications below | 
Product Information
27571-1-AP targets GLUT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag25682 Product name: Recombinant human SLC2A5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 357-399 aa of BC001820 Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI Predict reactive species | 
                                    
| Full Name | solute carrier family 2 (facilitated glucose/fructose transporter), member 5 | 
| Calculated Molecular Weight | 55 kDa | 
| Observed Molecular Weight | 48-70 kDa | 
| GenBank Accession Number | BC001820 | 
| Gene Symbol | GLUT5 | 
| Gene ID (NCBI) | 6518 | 
| RRID | AB_2880913 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P22732 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
GLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLUT5 antibody 27571-1-AP | Download protocol | 
| WB protocol for GLUT5 antibody 27571-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Metab High dietary fructose promotes hepatocellular carcinoma progression by enhancing O-GlcNAcylation via microbiota-derived acetate | ||
Nutrients Acute Low-Intensity Treadmill Running Upregulates the Expression of Intestinal Glucose Transporters via GLP-2 in Mice. | ||
iScience Celastrol inhibits intestinal lipid absorption by reprofiling the gut microbiota to attenuate high-fat diet-induced obesity. | ||
J Adv Res miR-155 down-regulation protects the heart from hypoxic damage by activating fructose metabolism in cardiac fibroblasts | ||
J Zhejiang Univ Sci B Diacylated anthocyanins from purple sweet potato (Ipomoeabatatas L.) attenuate hyperglycemia and hyperuricemia in mice induced by a high-fructose/high-fat diet | 











