Product Information
85878-1-PBS targets GLUT5 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26091 Product name: Recombinant human SLC2A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 357-399 aa of BC001820 Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose/fructose transporter), member 5 |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC001820 |
| Gene Symbol | GLUT5 |
| Gene ID (NCBI) | 6518 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P22732 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011).



