GLUT5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85878-1-RR (same clone as 85878-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85878-1-RR (GLUT5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85878-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85878-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85878-1-RR against Human GLUT5 were performed. The affinity constant is 1.87 nM.

GLUT5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85878-1-PBS

Clone No.250150F11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

GLUT-5, SLC2A5

---

Product Information

85878-1-PBS targets GLUT5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26091

  Product name: Recombinant human SLC2A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 357-399 aa of BC001820

  Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI

• Full Name: solute carrier family 2 (facilitated glucose/fructose transporter), member 5
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC001820
• Gene Symbol: GLUT5
• Gene ID (NCBI): 6518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22732
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011).