Tested Applications
Positive WB detected in | A549 cells, Jurkat cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26484-1-AP targets GNB1L in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24391 Product name: Recombinant human GNB1L protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 187-278 aa of BC012060 Sequence: DGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIR Predict reactive species |
Full Name | guanine nucleotide binding protein (G protein), beta polypeptide 1-like |
Calculated Molecular Weight | 327 aa, 36 kDa |
Observed Molecular Weight | 36 kDa, 18 kDa |
GenBank Accession Number | BC012060 |
Gene Symbol | GNB1L |
Gene ID (NCBI) | 54584 |
RRID | AB_3085876 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BYB4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GNB1L (G-protein subunit beta 1 like), located at 22q11.2, encodes a G-protein L-subunit-like polypeptide which is a member of the WD repeat protein family (PMID: 20538345). In humans, the hemizygous deletion of GNB1L can cause sensorimotor gating defects, which are related to schizophrenia and other serious mental diseases (PMID: 32847500). Moreover, GNB1L is a key regulator of DDR signaling via its role as a co-chaperone specifically regulating PIKK proteins (PMID: 37541219). GNB1L has 2 isoforms 36 kDa and 22 kDa, about 22 kDa which may be produced by Alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GNB1L antibody 26484-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |