CoraLite® Plus 488-conjugated GOLIM4 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-84818-5

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 GOLIM4 antibody (CL488-84818-5, Clone: 242323F4 ) at dilution of 1:200.

GOLIM4 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84818-5

Clone No.242323F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

242323F4, GIMPC, GOLPH4, GPP130, P 138

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84818-5 targets GOLIM4 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34962

  Product name: Recombinant human GOLIM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-500 aa of NM_014498

  Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ

• Full Name: golgi integral membrane protein 4
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: NM_014498
• Gene Symbol: GOLIM4
• Gene ID (NCBI): 27333
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00461
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697).