Tested Applications
| Positive WB detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
26739-1-AP targets TGR5/GPBAR1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24893 Product name: Recombinant human GPBAR1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 250-330 aa of BC033625 Sequence: AYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Predict reactive species |
| Full Name | G protein-coupled bile acid receptor 1 |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC033625 |
| Gene Symbol | GPBAR1 |
| Gene ID (NCBI) | 151306 |
| RRID | AB_3669565 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDU6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TGR5, also known as GPBAR1 (G-protein coupled bile acid receptor 1) or M-BAR, is a cell-surface receptor for bile acid which belongs to the G-protein coupled receptor 1 family (20236244). TGR5 gene expression is widely distributed, including endocrine glands, adipocytes, muscles, immune organs, spinal cord, and the enteric nervous system (24411485, 20665558, 22521118). TGR5 activation has some important biological effects such as anti-inflammatory, energy homeostasis and metabolism, anti-apoptotic, and choleretic functions (24411485, 22521118). In addition, TGR5 is related to several diseases, such as Metabolic and cardiovascular disorders, Hepatic and pancreatic disorders, Inflammatory bowel diseases, Gastrointestinal cancer, and so on (24411485).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TGR5/GPBAR1 antibody 26739-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome | ||
Int Immunopharmacol Targeting TGR5 to mitigate liver fibrosis: Inhibition of hepatic stellate cell activation through modulation of mitochondrial fission | ||
Phytomedicine Yi-Fei-San-Jie Chinese medicine formula reverses immune escape by regulating deoxycholic acid metabolism to inhibit TGR5/STAT3/PD-L1 axis in lung cancer |
