Product Information
66926-1-Ig targets GPNMB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26747 Product name: Recombinant human GPNMB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 38-158 aa of BC011595 Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD Predict reactive species |
| Full Name | glycoprotein (transmembrane) nmb |
| Calculated Molecular Weight | 64 kDa |
| GenBank Accession Number | BC011595 |
| Gene Symbol | GPNMB |
| Gene ID (NCBI) | 10457 |
| RRID | AB_2882253 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GPNMB antibody 66926-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
66926-1-Ig is a GPNMB antibody with 29 total citations. It appears in high-impact journals including Nature, Immunity, Cancer Discovery, Nature Genetics, Nature Communications, Molecular Cell, and Genome Medicine. Research fields span neurodegenerative diseases (Alzheimer's, stroke), oncology (hepatocellular, renal cell, esophageal, breast, and lung cancers), immunology (macrophage/microglia biology, inflammasome signaling), fibrosis, cardiovascular disease, and reproductive endocrinology.
| Species | Application | Title |
|---|---|---|
Immunity Direct microglia replacement reveals pathologic and therapeutic contributions of brain macrophages to a monogenic neurological disease | ||
Cancer Discov A Circulating GPNMB-Based Multimodal Model Integrates Tumor-Immune Crosstalk to Predict Immunotherapy Response in Esophageal Cancer. | ||
Nat Genet Plasticity of human microglia and brain perivascular macrophages in aging and Alzheimer's disease. | ||
Nat Commun Ultra-precision deconvolution of spatial transcriptomics decodes immune heterogeneity and fate-defining programs in tissues. | ||
Reviews
What customers say
Both reviewers gave this GPNMB antibody a perfect 5-star rating. One user reported excellent Western Blot performance on cerebellum tissue at a 1:5000 dilution. The other praised its use for immunofluorescence and Western Blot on macrophages at the recommended 1:500 concentration, noting highly specific staining with minimal background noise and a very clear, distinct signal. Overall, customers find this antibody reliable, specific, and easy to use across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Pravin (Verified Customer) (04-03-2026) | Antiboy works well at this dilution.
|
Victor (Verified Customer) (06-16-2025) | Staining with the GPNMB antibody on myeloid cells using the recommended concentration for immunofluorescence is highly specific. The signal shows minimal background noise and appears very clear and distinct.
 |
