GPNMB Monoclonal antibody, PBS Only

• 

  WB analysis using 66926-1-Ig (same clone as 66926-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66926-1-Ig (GPNMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66926-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66926-1-Ig (same clone as 66926-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66926-1-Ig (GPNMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66926-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66926-1-Ig (same clone as 66926-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66926-1-Ig (GPNMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66926-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66926-1-Ig (same clone as 66926-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using GPNMB antibody (66926-1-Ig, Clone: 2B10B8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66926-1-PBS in a different storage buffer formulation.

GPNMB Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66926-1-PBS

Clone No.2B10B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

2B10B8, Hematopoietic growth factor inducible neurokinin-1 type, NMB, Osteoactivin, Transmembrane glycoprotein NMB

---

Product Information

66926-1-PBS targets GPNMB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26747

  Product name: Recombinant human GPNMB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 38-158 aa of BC011595

  Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD

• Full Name: glycoprotein (transmembrane) nmb
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC011595
• Gene Symbol: GPNMB
• Gene ID (NCBI): 10457
• RRID: AB_2882253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.