GPR105 Recombinant monoclonal antibody

• 

  WB analysis using 83511-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83511-1-RR (GPR105 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83511-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83511-1-RR against Human GPR105 were performed. The affinity constant is 3.59 nM.

GPR105 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83511-1-RR

Clone No.240498B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

P2RY14, P2Y purinoceptor 14, KIAA0001, G-protein coupled receptor 105, G protein coupled receptor 105

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells, human placenta tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83511-1-RR targets GPR105 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14105

  Product name: Recombinant human GPR105 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-338 aa of BC034989

  Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

• Full Name: purinergic receptor P2Y, G-protein coupled, 14
• Calculated Molecular Weight: 338 aa, 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC034989
• Gene Symbol: P2RY14
• Gene ID (NCBI): 9934
• RRID: AB_3671136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15391
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR105 (P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393).