Product Information
83511-1-PBS targets GPR105 as part of a matched antibody pair:
MP00509-1: 83511-2-PBS capture and 83511-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14105 Product name: Recombinant human GPR105 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 249-338 aa of BC034989 Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL Predict reactive species |
| Full Name | purinergic receptor P2Y, G-protein coupled, 14 |
| Calculated Molecular Weight | 338 aa, 39 kDa |
| GenBank Accession Number | BC034989 |
| Gene Symbol | P2RY14 |
| Gene ID (NCBI) | 9934 |
| RRID | AB_3671136 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15391 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GPR105 (P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393).
