GPR105 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 83511-1-RR (same clone as 83511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83511-1-RR (GPR105 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83511-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00509-1

  Cytometric bead array standard curve of MP00509-1, GPR105 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83511-2-PBS. Detection antibody: 83511-1-PBS. Standard: Ag14105. Range: 6.25-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 83511-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83511-1-RR against Human GPR105 were performed. The affinity constant is 3.59 nM.

GPR105 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83511-1-PBS

Clone No.240498B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

P2RY14, P2Y purinoceptor 14, KIAA0001, G-protein coupled receptor 105, G protein coupled receptor 105

---

Product Information

83511-1-PBS targets GPR105 as part of a matched antibody pair:

MP00509-1: 83511-2-PBS capture and 83511-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14105

  Product name: Recombinant human GPR105 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-338 aa of BC034989

  Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

• Full Name: purinergic receptor P2Y, G-protein coupled, 14
• Calculated Molecular Weight: 338 aa, 39 kDa
• GenBank Accession Number: BC034989
• Gene Symbol: P2RY14
• Gene ID (NCBI): 9934
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15391
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.