GPR155 Polyclonal antibody, PBS Only

• 

  WB analysis using 12659-1-AP (same clone as 12659-1-PBS)

  mouse brain lysates were subjected to SDS PAGE followed by western blot with 12659-1-AP (GPR155 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12659-1-AP (same clone as 12659-1-PBS)

  IP result of anti-GPR155 (IP:12659-1-AP, 4ug; Detection:12659-1-AP 1:300) with mouse brain tissue lysate 3000ug. This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 12659-1-AP (same clone as 12659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 12659-1-AP (same clone as 12659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12659-1-AP (same clone as 12659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12659-1-AP (same clone as 12659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12659-1-PBS in a different storage buffer formulation.

GPR155 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12659-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12659-1-PBS targets GPR155 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3328

  Product name: Recombinant human GPR155 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 540-870 aa of BC028730

  Sequence: MCMNQTAQAGGYEGFDQSQSHKVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQSGDQQLTRHVLLCLLLIIGLFANLYSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT

• Full Name: G protein-coupled receptor 155
• Calculated Molecular Weight: 870 aa, 97 kDa
• Observed Molecular Weight: 97 kDa, 75 kDa
• GenBank Accession Number: BC028730
• Gene Symbol: GPR155
• Gene ID (NCBI): 151556
• RRID: AB_2877869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z3F1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The G Protein-coupled receptor 155 (GPR155), also known as Lysosomal cholesterol signaling protein (LYCHOS), is a cholesterol receptor on the lysosome. GRR155 plays a role in the cholesterol-sensing lysosomal pathway and couples cholesterol concentration to MTORC1-dependent anabolic signaling (PMID: 36007018). GPR155 may represent a biomarker for diagnosing and predicting hematogenous metastasis of gastric cancer (PMID: 28165032).