GPR155 Polyclonal antibody

• 

  WB analysis using 12659-1-AP

  mouse brain lysates were subjected to SDS PAGE followed by western blot with 12659-1-AP (GPR155 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12659-1-AP

  IP result of anti-GPR155 (IP:12659-1-AP, 4ug; Detection:12659-1-AP 1:300) with mouse brain tissue lysate 3000ug.

• 

  IHC staining of human brain using 12659-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 12659-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12659-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12659-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12659-1-AP (GPR155 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GPR155 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12659-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

DEP.7, DEPDC3, G protein coupled receptor 155, GPR155, LYCHOS, PGR22

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

12659-1-AP targets GPR155 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3328

  Product name: Recombinant human GPR155 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 540-870 aa of BC028730

  Sequence: MCMNQTAQAGGYEGFDQSQSHKVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQSGDQQLTRHVLLCLLLIIGLFANLYSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT

• Full Name: G protein-coupled receptor 155
• Calculated Molecular Weight: 870 aa, 97 kDa
• Observed Molecular Weight: 97 kDa, 75 kDa
• GenBank Accession Number: BC028730
• Gene Symbol: GPR155
• Gene ID (NCBI): 151556
• RRID: AB_2877869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z3F1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The G Protein-coupled receptor 155 (GPR155), also known as Lysosomal cholesterol signaling protein (LYCHOS), is a cholesterol receptor on the lysosome. GRR155 plays a role in the cholesterol-sensing lysosomal pathway and couples cholesterol concentration to MTORC1-dependent anabolic signaling (PMID: 36007018). GPR155 may represent a biomarker for diagnosing and predicting hematogenous metastasis of gastric cancer (PMID: 28165032).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Pathol Res Pract; Circular RNA hsa_circ_0094976 modulates GPR155 to inhibit gastric adenocarcinoma malignant characteristics by targeting miR-223-3p; Authors - Li Liu