FITC-conjugated GPR65 Polyclonal antibody

• 

  FC experiment of RAW 264.7 using FITC-20306

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.8 ug FITC-conjugated GPR65 Polyclonal antibody (FITC-20306)(red), or 0.8 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

GPR65 Polyclonal Antibody for FC (Intra)

Cat No. FITC-20306

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

G protein coupled receptor 65, G-protein coupled receptor 65, hTDAG8, Psychosine receptor, T-cell death-associated gene 8 protein

---

Tested Applications

• Positive FC (Intra) detected in: RAW 264.7 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.8 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-20306 targets GPR65 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14139

  Product name: Recombinant human GPR65 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-337 aa of BC035633

  Sequence: CFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE

• Full Name: G protein-coupled receptor 65
• Calculated Molecular Weight: 337 aa, 39 kDa
• GenBank Accession Number: BC035633
• Gene Symbol: GPR65
• Gene ID (NCBI): 8477
• Conjugate: FITC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 498 nm / 526 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYL9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GPR65 (G protein-coupled receptor 65) was defined originally as T-cell death-associated gene 8 (TDAG8), functions as a proton-sensing receptor, and is also sensitive to psychosine (PMID: 35343079). GPR65 promotes adaptation to an acidic environment to enhance cell survival and proliferation, thereby promoting tumor development (PMID: 36852075).