Tested Applications
| Positive WB detected in | HEK-293 cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, SMMC-7721 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 23 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
29329-1-AP targets GPX1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31101 Product name: Recombinant human GPX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-203 aa of BC000742 Sequence: GGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA Predict reactive species |
| Full Name | glutathione peroxidase 1 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC000742 |
| Gene Symbol | GPX1 |
| Gene ID (NCBI) | 2876 |
| RRID | AB_2918283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07203 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gpx protein, known as selenoprotein, consists selenium in its catalytic site. Gpx1 is an abundant isoform, which involves in scavenging endogenous ROS using electron provided by reduced glutathione and ubiquitously expressed the cytoplasm and mitochondria of all cell types. (PMID: 30632027)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GPX1 antibody 29329-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Plant-derived hydrogel and photosynthetic nano-units for myocardial infarction therapy | ||
Mol Ther CircRNA Samd4 induces cardiac repair after myocardial infarction by blocking mitochondria-derived ROS output. | ||
Cell Death Discov Allicin promotes functional recovery in ischemic stroke via glutathione peroxidase-1 activation of Src-Akt-Erk
| ||
Mech Ageing Dev WDR23 mediates NRF2 proteostasis and cytoprotective capacity in the hippocampus | ||
Molecules Polygonatum cyrtonema Hua Polysaccharides Protect BV2 Microglia Relief Oxidative Stress and Ferroptosis by Regulating NRF2/HO-1 Pathway | ||
Pharmaceuticals (Basel) Adrenomedullin Improves Cardiac Remodeling and Function in Obese Rats with Hypertension. |





