• Featured Product
  • KD/KO Validated

GPX4 Polyclonal antibody

GPX4 Polyclonal Antibody for WB, IF-P, FC (Intra), IP, ELISA
Cat No. 30388-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4, GSHPx 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HL-60 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, rat brain tissue
Positive IP detected inrat testis tissue
Positive IF-P detected inrat testis tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30388-1-AP targets GPX4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30650

Product name: Recombinant human GPX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 107-197 aa of BC021567

Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Predict reactive species
Full Name glutathione peroxidase 4 (phospholipid hydroperoxidase)
Observed Molecular Weight 18-23 kDa
GenBank Accession NumberBC021567
Gene Symbol GPX4
Gene ID (NCBI) 2879
RRIDAB_3086304
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP36969
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.

Protocols

Product Specific Protocols
FC protocol for GPX4 antibody 30388-1-APDownload protocol
IF protocol for GPX4 antibody 30388-1-APDownload protocol
IP protocol for GPX4 antibody 30388-1-APDownload protocol
WB protocol for GPX4 antibody 30388-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouseWB,IHC,IF

Bioact Mater

A two-pronged approach to inhibit ferroptosis of MSCs caused by the iron overload in postmenopausal osteoporosis and promote osseointegration of titanium implant

Authors - Yulu Yang
ratWB,IHC

Nat Commun

Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes

Authors - Wenkai Wang
ratWB

Adv Sci (Weinh)

ALKBH5-Mediated M6A Demethylation of G3BP1 Attenuates Ferroptosis Via Cytoplasmic Retention of YBX1/p53 in Diabetic Myocardial Ischemia-Reperfusion Injury

Authors - Wenyuan Li
mouse,humanWB,IF

Sci Adv

In situ implantable DNA hydrogel for diagnosis and therapy of postoperative rehemorrhage following intracerebral hemorrhage surgery

Authors - Wenyan Yu
mouseWB

J Hazard Mater

Investigating the potential risk of cadmium exposure on seizure severity and anxiety-like behaviors through the ferroptosis pathway in epileptic mice: An integrated multi-omics approach

Authors - Yuanjin Chang

Biomaterials

An activatable polymeric nano-spy for reversing the progression of diabetic osteoporosis

Authors - Shenhua Li
Loading...
||
New chat

Able

正在加载,请稍候...