Tested Applications
| Positive WB detected in | HCT 116 cells, HL-60 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | rat testis tissue |
| Positive IF-P detected in | rat testis tissue |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 149 publications below |
| IHC | See 24 publications below |
| IF | See 25 publications below |
| IP | See 1 publications below |
Product Information
30388-1-AP targets GPX4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
| Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
| Observed Molecular Weight | 18-23 kDa |
| GenBank Accession Number | BC021567 |
| Gene Symbol | GPX4 |
| Gene ID (NCBI) | 2879 |
| RRID | AB_3086304 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36969 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GPX4 antibody 30388-1-AP | Download protocol |
| IF protocol for GPX4 antibody 30388-1-AP | Download protocol |
| IP protocol for GPX4 antibody 30388-1-AP | Download protocol |
| WB protocol for GPX4 antibody 30388-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater A two-pronged approach to inhibit ferroptosis of MSCs caused by the iron overload in postmenopausal osteoporosis and promote osseointegration of titanium implant | ||
Nat Commun Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes | ||
Adv Sci (Weinh) ALKBH5-Mediated M6A Demethylation of G3BP1 Attenuates Ferroptosis Via Cytoplasmic Retention of YBX1/p53 in Diabetic Myocardial Ischemia-Reperfusion Injury | ||
J Hazard Mater Investigating the potential risk of cadmium exposure on seizure severity and anxiety-like behaviors through the ferroptosis pathway in epileptic mice: An integrated multi-omics approach | ||
Sci Adv In situ implantable DNA hydrogel for diagnosis and therapy of postoperative rehemorrhage following intracerebral hemorrhage surgery | ||
Biomaterials An activatable polymeric nano-spy for reversing the progression of diabetic osteoporosis |













