GRHPR Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 51013-2-AP (same clone as 51013-2-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 51013-2-AP (GRHPR Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 51013-2-AP (same clone as 51013-2-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 51013-2-AP (GRHPR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 51013-2-AP (same clone as 51013-2-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 51013-2-AP (GRHPR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 51013-2-AP (same clone as 51013-2-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 51013-2-AP (GRHPR Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 51013-2-AP (same clone as 51013-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 51013-2-AP (GRHPR Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 51013-2-AP (same clone as 51013-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 51013-2-AP (GRHPR Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 51013-2-AP (same clone as 51013-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 51013-2-AP (GRHPR antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 51013-2-PBS in a different storage buffer formulation.

GRHPR Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 51013-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

51013-2-PBS targets GRHPR in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0484

  Product name: Recombinant human GRHPR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-328 aa of BC000605

  Sequence: VGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL

• Full Name: glyoxylate reductase/hydroxypyruvate reductase
• Calculated Molecular Weight: 328 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000605
• Gene Symbol: GRHPR
• Gene ID (NCBI): 9380
• RRID: AB_2113424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBQ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRHPR(Glyoxylate reductase/hydroxypyruvate reductase) is also named as GLXR and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The GRHPR gene encodes a predicted 328-amino acid protein with a calculated molecular mass of 35.5 kD. It has glyoxylate reductase (GR), hydroxypyruvate reductase (HPR) and D-glycerate dehydrogenase (DGDH) activities(PMID:16597637). Defects in GRHPR are the cause of hyperoxaluria primary type 2 (HP2)(PMID: 10484776). It can exsit as a homodimer(PMID:16756993).