Tested Applications
| Positive WB detected in | A549 cells, HeLa cells |
| Positive IHC detected in | human colon tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IF | See 1 publications below |
Product Information
26789-1-AP targets GRLF1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25353 Product name: Recombinant human GRLF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 890-1080 aa of BC150257 Sequence: DGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD Predict reactive species |
| Full Name | glucocorticoid receptor DNA binding factor 1 |
| Observed Molecular Weight | 172 kDa |
| GenBank Accession Number | BC150257 |
| Gene Symbol | GRLF1 |
| Gene ID (NCBI) | 2909 |
| RRID | AB_2880636 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRY4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GRLF1 is also named as ARHGAP35, p190ARHOGAP, KIAA1722, P190A and GRF1. GRLF1 is a kind of Rho GTPase-activating protein, and it binds several acidic phospholipids which inhibits the Rho GAP activity to promote the Rac GAP activity (PMID:19673492). This binding is inhibited by phosphorylation by PRKCA (PMID:19673492). GRLF1 is Involved in cell differentiation as well as cell adhesion and migration. And it plays an important role in retinal tissue morphogenesis, neural tube fusion, midline fusion of the cerebral hemispheres and mammary gland branching morphogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRLF1 antibody 26789-1-AP | Download protocol |
| WB protocol for GRLF1 antibody 26789-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Sec13 promotes oligodendrocyte differentiation and myelin repair through autocrine pleiotrophin signaling.
| ||
Oncogene Ubiquitin ligase TRIM65 promotes colorectal cancer metastasis by targeting ARHGAP35 for protein degradation. | ||
Front Cell Dev Biol Feedback-Driven Mechanisms Between Phosphorylated Caveolin-1 and Contractile Actin Assemblies Instruct Persistent Cell Migration. | ||
Cell Death Discov The m6A demethylases FTO and ALKBH5 aggravate the malignant progression of nasopharyngeal carcinoma by coregulating ARHGAP35 |











