• Featured Product
  • KD/KO Validated

GRLF1 Polyclonal antibody

GRLF1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26789-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

ARHGAP35, GRF 1, GRF1, GRLF1, KIAA1722, P190 A, P190A, p190RhoGAP, Rho GAP p190A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells
Positive IHC detected inhuman colon tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26789-1-AP targets GRLF1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25353

Product name: Recombinant human GRLF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 890-1080 aa of BC150257

Sequence: DGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD

Predict reactive species
Full Name glucocorticoid receptor DNA binding factor 1
Observed Molecular Weight 172 kDa
GenBank Accession NumberBC150257
Gene Symbol GRLF1
Gene ID (NCBI) 2909
RRIDAB_2880636
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NRY4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRLF1 is also named as ARHGAP35, p190ARHOGAP, KIAA1722, P190A and GRF1. GRLF1 is a kind of Rho GTPase-activating protein, and it binds several acidic phospholipids which inhibits the Rho GAP activity to promote the Rac GAP activity (PMID:19673492). This binding is inhibited by phosphorylation by PRKCA (PMID:19673492). GRLF1 is Involved in cell differentiation as well as cell adhesion and migration. And it plays an important role in retinal tissue morphogenesis, neural tube fusion, midline fusion of the cerebral hemispheres and mammary gland branching morphogenesis.

Protocols

Product Specific Protocols
IHC protocol for GRLF1 antibody 26789-1-APDownload protocol
WB protocol for GRLF1 antibody 26789-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Clin Invest

Sec13 promotes oligodendrocyte differentiation and myelin repair through autocrine pleiotrophin signaling.

Authors - Zhixiong Liu
  • KD Validated
humanWB,IF

Oncogene

Ubiquitin ligase TRIM65 promotes colorectal cancer metastasis by targeting ARHGAP35 for protein degradation.

Authors - Daici Chen
humanWB

Front Cell Dev Biol

Feedback-Driven Mechanisms Between Phosphorylated Caveolin-1 and Contractile Actin Assemblies Instruct Persistent Cell Migration.

Authors - Xuemeng Shi
humanWB

Cell Death Discov

The m6A demethylases FTO and ALKBH5 aggravate the malignant progression of nasopharyngeal carcinoma by coregulating ARHGAP35

Authors - Zhiyuan Yang
Loading...
||
New chat Able
正在加载,请稍候...