Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 11 publications below |
IHC | See 5 publications below |
Product Information
27630-1-AP targets GSDMC in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26365 Product name: Recombinant human GSDMC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-247 aa of NM_031415 Sequence: MPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISE Predict reactive species |
Full Name | gasdermin C |
Calculated Molecular Weight | 58 kDa |
Observed Molecular Weight | ~60 kDa |
GenBank Accession Number | NM_031415 |
Gene Symbol | GSDMC |
Gene ID (NCBI) | 56169 |
RRID | AB_2880930 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BYG8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GSDMC antibody 27630-1-AP | Download protocol |
IHC protocol for GSDMC antibody 27630-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Immunity Disruption of the endopeptidase ADAM10-Notch signaling axis leads to skin dysbiosis and innate lymphoid cell-mediated hair follicle destruction. | ||
Nat Cell Biol PD-L1-mediated gasdermin C expression switches apoptosis to pyroptosis in cancer cells and facilitates tumour necrosis.
| ||
J Clin Invest Gasdermin C sensitizes tumor cells to PARP inhibitor therapy in cancer models | ||
Am J Cancer Res Pyroptosis impacts the prognosis and treatment response in gastric cancer via immune system modulation. | ||
Front Oncol siRNAs Targeting Mouse-Specific lncRNA AA388235 Induce Human Tumor Cell Pyroptosis/Apoptosis. | ||
Exp Ther Med Tetracaine hydrochloride induces macrophage pyroptosis through caspase‑1/11‑GSDMD signaling pathways |