Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 11 publications below |
| IHC | See 5 publications below |
Product Information
27630-1-AP targets GSDMC in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26365 Product name: Recombinant human GSDMC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-247 aa of NM_031415 Sequence: MPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISE Predict reactive species |
| Full Name | gasdermin C |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | ~60 kDa |
| GenBank Accession Number | NM_031415 |
| Gene Symbol | GSDMC |
| Gene ID (NCBI) | 56169 |
| RRID | AB_2880930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BYG8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GSDMC antibody 27630-1-AP | Download protocol |
| WB protocol for GSDMC antibody 27630-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity Disruption of the endopeptidase ADAM10-Notch signaling axis leads to skin dysbiosis and innate lymphoid cell-mediated hair follicle destruction. | ||
Nat Cell Biol PD-L1-mediated gasdermin C expression switches apoptosis to pyroptosis in cancer cells and facilitates tumour necrosis.
| ||
J Clin Invest Gasdermin C sensitizes tumor cells to PARP inhibitor therapy in cancer models | ||
Am J Cancer Res Pyroptosis impacts the prognosis and treatment response in gastric cancer via immune system modulation. | ||
Front Oncol siRNAs Targeting Mouse-Specific lncRNA AA388235 Induce Human Tumor Cell Pyroptosis/Apoptosis. | ||
Exp Ther Med Tetracaine hydrochloride induces macrophage pyroptosis through caspase‑1/11‑GSDMD signaling pathways |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Haley (Verified Customer) (10-13-2025) | Works well for Western blot applications
|







