Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, human brain tissue, Jurkat cells, HEK-293 cells, K-562 cells, PC-3 cells, mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse skin tissue, human colon, human liver tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15902-1-AP targets GSTP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8731 Product name: Recombinant human GSTP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species |
| Full Name | glutathione S-transferase pi 1 |
| Calculated Molecular Weight | 210 aa, 23 kDa |
| Observed Molecular Weight | 23-28 kDa |
| GenBank Accession Number | BC010915 |
| Gene Symbol | GSTP1 |
| Gene ID (NCBI) | 2950 |
| RRID | AB_2116216 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09211 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glutathione S-transferase Pi (GSTP1) is anisozyme encoded by the GST pi gene that plays an importantregulatory role in detoxification, anti‑oxidative damage, and the occurrence of various diseases (PMID: 14755684). GSTP1 conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PMID:9084911). GSTP1 methylation is frequently associated with tumor development or poor prognosis in a wide range of tumors such as neuroblastoma, hepatocellular carcinoma, endometrial, breast, and prostate cancers (PCa) (PMID: 27594734).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GSTP1 antibody 15902-1-AP | Download protocol |
| IF protocol for GSTP1 antibody 15902-1-AP | Download protocol |
| IHC protocol for GSTP1 antibody 15902-1-AP | Download protocol |
| IP protocol for GSTP1 antibody 15902-1-AP | Download protocol |
| WB protocol for GSTP1 antibody 15902-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GSTP1 Polyclonal antibody (Cat# 15902-1-AP) has 48 citations. Publications appear in journals including Science, Nature Communications, Redox Biology, Molecular Cell, Cell Death & Disease, International Journal of Biological Sciences, Free Radical Biology and Medicine, Oncotarget, Human Molecular Genetics, and PLoS ONE. Research fields span redox biology and S-glutathionylation, ferroptosis, cancer biology (breast, ovarian, prostate, glioblastoma), hepatotoxicity, cardiomyopathy, neurology, aging, metabolism, and toxicology.
| Species | Application | Title |
|---|---|---|
Science Multiscale photocatalytic proximity labeling reveals cell surface neighbors on and between cells | ||
Redox Biol GSTP1-mediated S-glutathionylation of Pik3r1 is a redox hub that inhibits osteoclastogenesis through regulating autophagic flux
| ||
Redox Biol Redox signaling-mediated S-glutathionylation of protein disulfide isomerase A1 initiates intrinsic apoptosis and contributes to accelerated aging | ||
Redox Biol Small molecule HCY-NBD stabilizes GSTM2 via cys174 sulfenylation to attenuate high glucose induced endothelial cell senescence and calcification. | ||
Mol Cell Deciphering functional tumor-immune crosstalk through highly multiplexed imaging and deep visual proteomics |
Reviews
What customers say
The product received a 5-star rating from a single reviewer who used it for Western Blot at a 1:1000 dilution on liver tissue. The reviewer reported that it "works pretty well," indicating satisfactory performance for their application. Overall, the limited feedback suggests the antibody performs reliably under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
James (Verified Customer) (11-30-2022) | Works pretty well.
 |
