CoraLite® Plus 555-conjugated GSTP1 Polyclonal antibody

• 

  FC experiment of Jurkat using CL555-15902

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 555-conjugated GSTP1 Polyclonal antibody (CL555-15902)(red), or 0.4 ug CoraLite®555-conjugated Rabbit IgG control Rabbit PolyAb (CL555-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

GSTP1 Polyclonal Antibody for FC (Intra)

Cat No. CL555-15902

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

EC:2.5.1.18, FAEES3, Glutathione S-transferase P, GST3, GST3/GST pi

---

Tested Applications

• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-15902 targets GSTP1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8731

  Product name: Recombinant human GSTP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC010915

  Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Full Name: glutathione S-transferase pi 1
• Calculated Molecular Weight: 210 aa, 23 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC010915
• Gene Symbol: GSTP1
• Gene ID (NCBI): 2950
• RRID: AB_3084530
• Conjugate: CoraLite® Plus 555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 554 nm / 570 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09211
• Storage Buffer: PBS with 50% Glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glutathione S-transferase P (GSTP1) conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276).