• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated GSTP1 Polyclonal antibody

GSTP1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-15902

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

EC:2.5.1.18, FAEES3, Glutathione S-transferase P, GST3, GST3/GST pi

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-15902 targets GSTP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8731

Product name: Recombinant human GSTP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-210 aa of BC010915

Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Predict reactive species
Full Name glutathione S-transferase pi 1
Calculated Molecular Weight 210 aa, 23 kDa
Observed Molecular Weight 23-28 kDa
GenBank Accession NumberBC010915
Gene Symbol GSTP1
Gene ID (NCBI) 2950
RRIDAB_2934919
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09211
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glutathione S-transferase P (GSTP1) conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 GSTP1 antibody CL647-15902Download protocol
IF protocol for CL Plus 647 GSTP1 antibody CL647-15902Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...