Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IP detected in | rat liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22371-1-AP targets GYS2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18012 Product name: Recombinant human GYS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 604-703 aa of BC126310 Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN Predict reactive species |
| Full Name | glycogen synthase 2 (liver) |
| Calculated Molecular Weight | 703 aa, 81 kDa |
| Observed Molecular Weight | 81 kDa |
| GenBank Accession Number | BC126310 |
| Gene Symbol | GYS2 |
| Gene ID (NCBI) | 2998 |
| RRID | AB_2879091 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54840 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GYS2 antibody 22371-1-AP | Download protocol |
| IP protocol for GYS2 antibody 22371-1-AP | Download protocol |
| WB protocol for GYS2 antibody 22371-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GYS2 Polyclonal antibody (catalog number 22371-1-AP) has 26 citations. These appear in journals including Nature, Cell Metabolism, Nature Communications, Metabolism, Carbohydrate Polymers, Environmental International, Journal of Translational Medicine, Microbiological Research, Current Research in Food Science, Journal of Agricultural and Food Chemistry, Biochemical Pharmacology, Life Sciences, Molecular Metabolism, Food & Function, Nutrients, Frontiers in Nutrition, Journal of Lipid Research, iScience, Frontiers in Molecular Neuroscience, American Journal of Physiology, BMC Gastroenterology, Animals, Placenta, and Journal of Food Biochemistry. Research fields center on glycogen metabolism, glucose homeostasis, insulin resistance, diabetes, and hepatic lipid metabolism.
| Species | Application | Title |
|---|---|---|
Cell Metab Fructose-1,6-bisphosphatase is a nonenzymatic safety valve that curtails AKT activation to prevent insulin hyperresponsiveness | ||
Nat Commun N6-methyladenosine modification governs liver glycogenesis by stabilizing the glycogen synthase 2 mRNA | ||
Nat Commun Multi-layered transcriptional control of glycogen metabolism coordinates thermogenic remodeling of white adipocytes in male mice. | ||
Metabolism Recurrent hypoglycemia increases hepatic gluconeogenesis without affecting glycogen metabolism or systemic lipolysis in rat | ||
