Glucocorticoid receptor Recombinant monoclonal antibody

• 

  WB analysis using 82619-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 82619-4-RR

  IP result of anti-Glucocorticoid receptor (IP:82619-4-RR, 4ug; Detection:82619-4-RR 1:8000) with HepG2 cells lysate 1920 ug.

• 

  IHC staining of human ovary cancer using 82619-4-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 82619-4-RR

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 82619-4-RR

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 82619-4-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 82619-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glucocorticoid receptor antibody (82619-4-RR, Clone: 2F22 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• 

  ChIP experiment of A549 using 82619-4-RR

  Chromatin was prepared from A549 cells that were cultured in media with 5% charcoal-stripped FBS for 3 d and then treated with dexamethasone (100 nM, 1 h). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of Glucocorticoid receptor (82619-4-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR.

• 

  Affinity and Kinetic Characterization of 82619-4-RR

  Biolayer interferometry (BLl) kinetic assays of 82619-4-RR against Human Glucocorticoid receptor were performed. The affinity constant is 0.693 nM.

Glucocorticoid receptor Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR

Cat No. 82619-4-RR

Clone No.2F22

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR

Synonyms

NR3C1, 2F22, GCCR, GCR, GR

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, U-251 cells, DU 145 cells, MCF-7 cells, L-929 cells, RAW 264.7 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human prostate cancer tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive ChIP-qPCR detected in: dexamethasone (100 nM, 1 h) A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:175-1:700
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• CHIP-QPCR: CHIP-QPCR : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

82619-4-RR targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21146

  Product name: Recombinant human Glucocorticoid receptor protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC015610

  Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

• Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 94-97 kDa
• GenBank Accession Number: BC015610
• Gene Symbol: Glucocorticoid receptor
• Gene ID (NCBI): 2908
• RRID: AB_3086492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04150
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,rat	WB	Phytomedicine; Ginsenoside Rb1 alleviates atherosclerosis by modulating vascular smooth muscle cell proliferation, foam cell formation, and autophagy.; Authors - Huan-Huan Yuan