Glucocorticoid receptor Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82619-4-RR (same clone as 82619-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 82619-4-RR (same clone as 82619-4-PBS)

  IP result of anti-Glucocorticoid receptor (IP:82619-4-RR, 4ug; Detection:82619-4-RR 1:8000) with HepG2 cells lysate 1920 ug. This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 82619-4-RR (same clone as 82619-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 82619-4-RR (same clone as 82619-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 82619-4-RR (same clone as 82619-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 82619-4-RR (same clone as 82619-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82619-4-RR (same clone as 82619-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glucocorticoid receptor antibody (82619-4-RR, Clone: 2F22 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 82619-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82619-4-RR

  Biolayer interferometry (BLl) kinetic assays of 82619-4-RR against Human Glucocorticoid receptor were performed. The affinity constant is 0.693 nM.

Glucocorticoid receptor Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 82619-4-PBS

Clone No.2F22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

NR3C1, GRL, GR, GCR, GCCR

---

Product Information

82619-4-PBS targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21146

  Product name: Recombinant human Glucocorticoid receptor protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC015610

  Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

• Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 94-97 kDa
• GenBank Accession Number: BC015610
• Gene Symbol: Glucocorticoid receptor
• Gene ID (NCBI): 2908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04150
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).