Anti-Human Glycophorin B/CD235b Rabbit Recombinant Antibody, PBS Only

• 

  SEC-HPLC of 98663-1-RR

  The purity of Human Glycophorin B/CD235b Recombinant monoclonal antibody (Cat. No. 98663-1-RR) was greater than 95% as determined by SEC-HPLC.

• 

  FC experiment of Human peripheral blood erythrocytes using 98663-1-RR (same clone as 98663-1-PBS)

  1x10^6 human peripheral blood erythrocytes were surface stained with 0.25 ug Anti-Human Glycophorin B/CD235b Rabbit RecAb (98663-1-RR, Clone: 250515H8) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98663-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Human peripheral blood erythrocytes using 98663-1-RR (same clone as 98663-1-PBS)

  1x10^6 human peripheral blood erythrocytes were surface stained with 0.25 ug Anti-Human Glycophorin B/CD235b Rabbit RecAb (98663-1-RR, Clone: 250515H8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98663-1-PBS in a different storage buffer formulation.

• 

  Affinity of 98663-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98663-1-RR against Human Glycophorin B/CD235b were performed. The affinity constant is 1.08 nM.

Glycophorin B/CD235b Uni-rAb^® Recombinant Antibody for FC

Cat No. 98663-1-PBS

Clone No.250515H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

GYPB, Glycophorin B, GlycophorinB, Glycophorin-B, SS active sialoglycoprotein

---

Product Information

98663-1-PBS targets Glycophorin B/CD235b in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3516

  Product name: recombinant human GYPB protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-59 aa of BC121077

  Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA

• Full Name: glycophorin B (MNS blood group)
• GenBank Accession Number: BC121077
• Gene Symbol: GYPB
• Gene ID (NCBI): 2994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06028
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glycophorin B/CD235b (GYPB) is a single-pass transmembrane sialoglycoprotein expressed on the surface of human red blood cells (RBCs). Glycophorin B/CD235b is primarily known for determining the Ss blood group and playing a role in malaria susceptibility.It is encoded by the GYPB gene and is structurally similar to glycophorin A (GPA), though present at lower abundance.