Tested Applications
| Positive FC detected in | Human peripheral blood erythrocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98663-1-RR targets Glycophorin B/CD235b in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3516 Product name: recombinant human GYPB protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-59 aa of BC121077 Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA Predict reactive species |
| Full Name | glycophorin B (MNS blood group) |
| GenBank Accession Number | BC121077 |
| Gene Symbol | GYPB |
| Gene ID (NCBI) | 2994 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P06028 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Glycophorin B/CD235b (GYPB) is a single-pass transmembrane sialoglycoprotein expressed on the surface of human red blood cells (RBCs). Glycophorin B/CD235b is primarily known for determining the Ss blood group and playing a role in malaria susceptibility.It is encoded by the GYPB gene and is structurally similar to glycophorin A (GPA), though present at lower abundance.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Glycophorin B/CD235b antibody 98663-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







