Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84374-4-RR targets HAPLN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25221 Product name: Recombinant human HAPLN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-131 aa of BC057808 Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTL Predict reactive species |
| Full Name | hyaluronan and proteoglycan link protein 1 |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC057808 |
| Gene Symbol | HAPLN1 |
| Gene ID (NCBI) | 1404 |
| RRID | AB_3671910 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P10915 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HAPLN1 (hyaluronan and proteoglycan link protein 1), also known as CRTL1. It is expected to be located in the cytoplasm and extracellular, and the protein is mainly expressed in placenta and small intestine. The calculated molecular weight of HAPLN1 is 40 kDa. HAPLN1 binds to aggrecan on the hyaluronic chain, stabilizing the aggregates and thus increasing compression resistance and shock absorption. HAPLN1 also functions as a growth factor, up regulating aggrecan and type II collagen synthesis in cartilage. It seems to be an essential part of cartilage homeostasis and may also contribute to homeostasis in the disc tissue (PMID: 23537453). It is reported in the literature that it is a double band.(PMID: 26341258)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HAPLN1 antibody 84374-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



