HAPLN1 Recombinant monoclonal antibody, PBS Only

HAPLN1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84374-4-PBS
Clone No.241588E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Proteoglycan link protein, CRTL1, CRT1, Cartilage-linking protein 1, Cartilage-link protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84374-4-PBS targets HAPLN1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25221

Product name: Recombinant human HAPLN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 16-131 aa of BC057808

Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTL

Predict reactive species
Full Name hyaluronan and proteoglycan link protein 1
Calculated Molecular Weight 40 kDa
Observed Molecular Weight40-45 kDa
GenBank Accession NumberBC057808
Gene Symbol HAPLN1
Gene ID (NCBI) 1404
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10915
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HAPLN1 (hyaluronan and proteoglycan link protein 1), also known as CRTL1. It is expected to be located in the cytoplasm and extracellular, and the protein is mainly expressed in placenta and small intestine. The calculated molecular weight of HAPLN1 is 40 kDa. HAPLN1 binds to aggrecan on the hyaluronic chain, stabilizing the aggregates and thus increasing compression resistance and shock absorption. HAPLN1 also functions as a growth factor, up regulating aggrecan and type II collagen synthesis in cartilage. It seems to be an essential part of cartilage homeostasis and may also contribute to homeostasis in the disc tissue (PMID: 23537453). It is reported in the literature that it is a double band.(PMID: 26341258)

Loading...
||
New chat Able
正在加载,请稍候...