• Featured Product
  • KD/KO Validated

HDAC3 Recombinant monoclonal antibody, PBS Only

HDAC3 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 81211-1-PBS
Clone No.2N1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

2N1, EC:3.5.1.-, EC:3.5.1.98, HDAC 3, Histone deacetylase 3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81211-1-PBS targets HDAC3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0396

Product name: Recombinant human HDAC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 187-395 aa of BC000614

Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA

Predict reactive species
Full Name histone deacetylase 3
Calculated Molecular Weight 49 kDa
Observed Molecular Weight49 kDa
GenBank Accession NumberBC000614
Gene Symbol HDAC3
Gene ID (NCBI) 8841
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15379
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. Histone deacetylase (HDAC) and histone acetyltransferase (HAT) are enzymes that regulate transcription by selectively deacetylating or acetylating the (-amino groups of lysines located near the amino termini of core histone proteins. At least 4 classes of HDAC were identified. HDAC3 is a class I HDAC. HDAC3 has histone deacetylase activity and may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. HDAC3 can also down-regulate p53 function and thus modulate cell growth and apoptosis. The gene encoding HDAC3 is regarded as a potential tumor suppressor gene.

Loading...
||
New chat Able
正在加载,请稍候...