Product Information
81211-1-PBS targets HDAC3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0396 Product name: Recombinant human HDAC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species |
| Full Name | histone deacetylase 3 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC000614 |
| Gene Symbol | HDAC3 |
| Gene ID (NCBI) | 8841 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15379 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. Histone deacetylase (HDAC) and histone acetyltransferase (HAT) are enzymes that regulate transcription by selectively deacetylating or acetylating the (-amino groups of lysines located near the amino termini of core histone proteins. At least 4 classes of HDAC were identified. HDAC3 is a class I HDAC. HDAC3 has histone deacetylase activity and may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. HDAC3 can also down-regulate p53 function and thus modulate cell growth and apoptosis. The gene encoding HDAC3 is regarded as a potential tumor suppressor gene.













