HDAC3 Recombinant monoclonal antibody

• 

  WB analysis using 81211-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81211-1-RR (HDAC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HAP1 using 81211-1-RR

  WB result of HDAC3 antibody (81211-1-RR; 1:2000; room temperature for 1.5 hours) with wild-type and sg-HDAC3 transfected HAP1 cells

• 

  IHC staining of human liver cancer using 81211-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 81211-1-RR (HDAC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 81211-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 81211-1-RR (HDAC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 81211-1-RR

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 81211-1-RR (HDAC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 81211-1-RR

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 81211-1-RR (HDAC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 81211-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81211-1-RR against Human HDAC3 were performed. The affinity constant is 0.213 nM.

• Featured Product
• KD/KO Validated

HDAC3 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 81211-1-RR

Clone No.2N1

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

2N1, EC:3.5.1.-, EC:3.5.1.98, HDAC 3, Histone deacetylase 3

---

Tested Applications

• Positive WB detected in: HeLa cells, HAP1 cells, HepG2 cells, MOLT-4 cells, Caco-2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: human thyroid cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

81211-1-RR targets HDAC3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0396

  Product name: Recombinant human HDAC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-395 aa of BC000614

  Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA

• Full Name: histone deacetylase 3
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC000614
• Gene Symbol: HDAC3
• Gene ID (NCBI): 8841
• RRID: AB_2923709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15379
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. Histone deacetylase (HDAC) and histone acetyltransferase (HAT) are enzymes that regulate transcription by selectively deacetylating or acetylating the (-amino groups of lysines located near the amino termini of core histone proteins. At least 4 classes of HDAC were identified. HDAC3 is a class I HDAC. HDAC3 has histone deacetylase activity and may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. HDAC3 can also down-regulate p53 function and thus modulate cell growth and apoptosis. The gene encoding HDAC3 is regarded as a potential tumor suppressor gene.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Discov; The dual HDAC/PI3K inhibitor CUDC-907 inhibits the growth and proliferation of MYC-driven Group 3 medulloblastoma; Authors - Pan Gou