Product Information
67364-1-PBS targets HDAC9 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species |
Full Name | histone deacetylase 9 |
Calculated Molecular Weight | 1011 aa, 111 kDa |
Observed Molecular Weight | 130 kDa |
GenBank Accession Number | BC152405 |
Gene Symbol | HDAC9 |
Gene ID (NCBI) | 9734 |
RRID | AB_2882616 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9UKV0 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
HDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle and testis.