Tested Applications
| Positive WB detected in | HeLa cells, Daudi cells, HepG2 cells, Raji cells, K-562 cells, Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67364-1-Ig targets HDAC9 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species |
| Full Name | histone deacetylase 9 |
| Calculated Molecular Weight | 1011 aa, 111 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC152405 |
| Gene Symbol | HDAC9 |
| Gene ID (NCBI) | 9734 |
| RRID | AB_2882616 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UKV0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle and testis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HDAC9 antibody 67364-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HDAC9 Monoclonal antibody (1G6C5), catalog number 67364-1-Ig, has 6 total citations. These appear in journals including Advanced Science, Cell Death & Disease, Archives of Pharmacal Research, Cell Reports, Journal of Orthopaedic Surgery and Research, and International Journal of Ophthalmology. The research fields span epigenetics and m6A regulation, esophageal squamous cell carcinoma metastasis, neuroblastoma progression, intervertebral disc degeneration, and retinal microvascular endothelial cell biology under high glucose conditions.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) N6-Methyladenosine Regulates Cilia Elongation in Cancer Cells by Modulating HDAC6 Expression | ||
Cell Death Dis WNT5A promotes the metastasis of esophageal squamous cell carcinoma by activating the HDAC7/SNAIL signaling pathway. | ||
Arch Pharm Res Pharmacological targeting of HDAC/BET pathway enhances 5-FU efficacy in esophageal squamous cancer cells. | ||
Cell Rep High fructose promotes MYCN-amplified neuroblastoma progression through NgBR-ACSS2-mediated biosynthesis of acetyl-CoA | ||
J Orthop Surg Res HDAC9 drives intervertebral disc degeneration by potentiating STAT1-mediated senescence and inflammation.
| ||
Int J Ophthalmol Down-regulation of histone deacetylase 7 reduces biological activities of retinal microvascular endothelial cells under high glucose condition and related mechanism |
Reviews
What customers say
The single review for this product is highly positive (5 stars). The user reported successful performance in both Western Blot and Immunoprecipitation at a 1:000 dilution using primary epithelial cells. Specifically, the antibody effectively detected MITR, a spliced form of HDAC9. Overall, the reviewer found the antibody reliable and well-suited for these applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lei (Verified Customer) (02-12-2026) | It works well with WB and IP to detect MITR (spliced form of HDAC9)
|
