HECTD1 Recombinant monoclonal antibody

• 

  WB analysis using 84918-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84918-5-RR (HECTD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 84918-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84918-5-RR against Human HECTD1 were performed. The affinity constant is 4.51 nM.

HECTD1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84918-5-RR

Clone No.242344A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HECT domain containing 1, EULIR, EC:2.3.2.26, E3 ubiquitin-protein ligase HECTD1, E3 ligase for inhibin receptor

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84918-5-RR targets HECTD1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14581

  Product name: Recombinant human HECTD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-121 aa of BC006237

  Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN

• Full Name: HECT domain containing 1
• Calculated Molecular Weight: 2612 aa, 290 kDa
• Observed Molecular Weight: 290 kDa
• GenBank Accession Number: BC006237
• Gene Symbol: HECTD1
• Gene ID (NCBI): 25831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULT8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HECTD1 (E3 ubiquitin-protein ligase), which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates,may be required for development of the head mesenchyme and neural tube closure.It is also involved in sporadic Parkinson's disease(PMID:16714300).This antibody is specific to HECTD1.