HGS Monoclonal antibody, PBS Only

• 

  WB analysis using 67818-1-Ig (same clone as 67818-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67818-1-Ig (HGS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 67818-1-Ig (same clone as 67818-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67818-1-Ig (HGS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 67818-1-Ig (same clone as 67818-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 67818-1-Ig (HGS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67818-1-Ig (same clone as 67818-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67818-1-Ig (HGS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67818-1-Ig (same clone as 67818-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67818-1-Ig (HGS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67818-1-Ig (same clone as 67818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67818-1-Ig (HGS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67818-1-Ig (same clone as 67818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67818-1-Ig (HGS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67818-1-Ig (same clone as 67818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67818-1-Ig (HGS antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67818-1-Ig (same clone as 67818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67818-1-Ig (HGS antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67818-1-Ig (same clone as 67818-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HGS antibody (67818-1-Ig, Clone: 3B10D6 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 67818-1-PBS in a different storage buffer formulation.

HGS Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67818-1-PBS

Clone No.3B10D6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HGS, HRS, Protein pp110, ZFYVE8

---

Product Information

67818-1-PBS targets HGS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28610

  Product name: Recombinant human HGS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 186-387 aa of BC003565

  Sequence: GQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPS

• Full Name: hepatocyte growth factor-regulated tyrosine kinase substrate
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC003565
• Gene Symbol: HGS
• Gene ID (NCBI): 9146
• RRID: AB_2918581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14964
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS, synonyms: HRS, ZFYVE8) is a 110 to 115-kDa zinc finger phosphotyrosine protein inducible by stimulation with interleukin 2 (IL-2), granulocyte-macrophage colony-stimulating factor (GM-CSF) as well as hepatocyte growth factor (HGF), and is associated with signal-transducing adaptor molecule (STAM). HGS suppresses DNA synthesis upon stimulation with IL-2 and GM-CSF, counteracting the function of STAM which is critical for cell growth signaling mediated by the cytokines. HGS also interacts with the neurofibromatosis 2 tumor suppressor protein schwannomin/merlin. The growth suppression activity of schwannomin/merlin requires HGS and the binding of schwannomin/merlin to HGS facilitates its ability to function as a tumor suppressor, probably by inhibiting STAT activation.