HINT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67583-1-Ig (same clone as 67583-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67583-1-Ig (HINT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67583-1-Ig (same clone as 67583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67583-1-Ig (HINT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67583-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67583-1-Ig (same clone as 67583-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67583-1-Ig (HINT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67583-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67583-1-Ig (same clone as 67583-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using HINT1 antibody (67583-1-Ig, Clone: 1G3E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67583-1-PBS in a different storage buffer formulation.

HINT1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67583-1-PBS

Clone No.1G3E4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FLJ30414, FLJ32340, HINT, HINT1, PKCI 1, PKCI1, PRKCNH1, Protein kinase C inhibitor 1

---

Product Information

67583-1-PBS targets HINT1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16662

  Product name: Recombinant human HINT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-126 aa of BC007090

  Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

• Full Name: histidine triad nucleotide binding protein 1
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC007090
• Gene Symbol: HINT1
• Gene ID (NCBI): 3094
• RRID: AB_2882793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49773
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.