CoraLite® Plus 488-conjugated HINT1 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67583

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 HINT1 antibody (CL488-67583, Clone: 1G3E4 ) at dilution of 1:200.

HINT1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67583

Clone No.1G3E4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF/ICC

Synonyms

FLJ30414, FLJ32340, HINT, HINT1, PKCI 1, PKCI1, PRKCNH1, Protein kinase C inhibitor 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67583 targets HINT1 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16662

  Product name: Recombinant human HINT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-126 aa of BC007090

  Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

• Full Name: histidine triad nucleotide binding protein 1
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC007090
• Gene Symbol: HINT1
• Gene ID (NCBI): 3094
• RRID: AB_3084361
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49773
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.