HLA class I (HLA-C) Polyclonal antibody

HLA class I (HLA-C) Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15777-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA, Cell treatment

HLA-C, HLA C, HLA class I histocompatibility antigen, C alpha chain, HLA Cw, HLA Cw12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, HeLa cells, HepG2 cells, Jurkat cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15777-1-AP targets HLA class I (HLA-C) in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8461

Product name: Recombinant human HLA class I (HLA-C) protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-305 aa of BC007814

Sequence: SMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTI

Predict reactive species
Full Name major histocompatibility complex, class I, C
Calculated Molecular Weight 366 aa, 41 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC007814
Gene Symbol HLA class I (HLA-C)
Gene ID (NCBI) 3107
RRIDAB_1639892
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10321
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. This polyclonal antibody raised against human HLA-C can also react with HLA-A and HLA-B. (PMID: 667938; 3375250)

Protocols

Product Specific Protocols
IF protocol for HLA class I (HLA-C) antibody 15777-1-APDownload protocol
IHC protocol for HLA class I (HLA-C) antibody 15777-1-APDownload protocol
IP protocol for HLA class I (HLA-C) antibody 15777-1-APDownload protocol
WB protocol for HLA class I (HLA-C) antibody 15777-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Pharmacol

Proteomics study the potential targets for Rifampicin-resistant spinal tuberculosis

Authors - Yanling Wang
mouseWB

Nat Commun

Neoantigen enriched biomimetic nanovaccine for personalized cancer immunotherapy

Authors - Yuwei Li
humanWB

J Matern Fetal Neonatal Med

HLA-C promotes proliferation and cell cycle progression in trophoblast cells

Authors - Hong Lv
mouseIF

Neuroscience

HLA is a potent immunoinflammatory target in asymptomatic Alzheimer's disease

Authors - Yingwei Zheng
humanCell treatment

Nature

Shifts in receptors during submergence of an encephalitic arbovirus

Authors - Wanyu Li
Loading...
||
New chat

Able

正在加载,请稍候...