• Featured Product
  • KD/KO Validated

HMGA2 Polyclonal antibody

HMGA2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20795-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

High mobility group AT-hook protein 2, High mobility group protein HMGI-C, HMGI C, HMGIC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HCT 116 cells, HepG2 cells, NCI-H1299 cells, NIH/3T3 cells, C6 cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman pancreas cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20795-1-AP targets HMGA2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14588

Product name: Recombinant human HMGA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-109 aa of NM_003483

Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Predict reactive species
Full Name high mobility group AT-hook 2
Calculated Molecular Weight 108 aa, 12 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberNM_003483
Gene Symbol HMGA2
Gene ID (NCBI) 8091
RRIDAB_2665377
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP52926
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HMGA2 belongs to the family of high mobility group with AT-hook DNA binding domain. HMGA proteins are considered architectural transcription factors; they do not have direct transcriptional activation capacity, but instead regulate gene expression by changing DNA conformation through binding to AT-rich regions in the DNA and/or direct interaction with other transcription factors (PMID: 18202751,19551524). HMGA2 is abundantly and ubiquitously expressed and plays a crucial role during embryonic development (18425117). HMGA2 promotes stem cell self-renewal and research studies have shown that decreased HMGA2 expression is associated with stem cell aging (19551524). Investigators have shown that expression levels of HMGA2 are very low in normal adult tissues, while either overexpression or rearrangement is associated with many types of cancer (PMID: 20228781). The calcualted molecular weight of HMGA2 is 12 kDa, but modified HMGA2 is about 18-20 kDa. (PMID: 18505920 )

Protocols

Product Specific Protocols
IF protocol for HMGA2 antibody 20795-1-APDownload protocol
IHC protocol for HMGA2 antibody 20795-1-APDownload protocol
IP protocol for HMGA2 antibody 20795-1-APDownload protocol
WB protocol for HMGA2 antibody 20795-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Nature

Ageing promotes metastasis via activation of the integrated stress response

Authors - Angana A H Patel
humanWB,IP,IHC,IF

Acta Pharm Sin B

Blockade of the deubiquitinating enzyme USP48 degrades oncogenic HMGA2 and inhibits colorectal cancer invasion and metastasis

Authors - Can Cheng
humanWB

Nat Commun

ICAM1 initiates CTC cluster formation and trans-endothelial migration in lung metastasis of breast cancer.

Authors - Rokana Taftaf
humanWB

Nat Commun

N6-methyladenosine modification of circNSUN2 facilitates cytoplasmic export and stabilizes HMGA2 to promote colorectal liver metastasis.

Authors - Ri-Xin Chen
humanWB

Cancer Res

Pooled CRISPR Screening Identifies P-Bodies as Repressors of Cancer Epithelial-Mesenchymal Transition

Authors - Liang Fang
rat,mouseWB

ACS Appl Mater Interfaces

Layered Double Hydroxide Nanoparticles with Osteogenic Effects as miRNA Carriers to Synergistically Promote Osteogenesis of MSCs.

Authors - Li Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mounika (Verified Customer) (01-08-2026)

These are the amazing antibodies , worked very well, helped us in our project

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:600
FH

Sai Sindhura (Verified Customer) (01-08-2026)

HMGA2 antibody gives very sharp bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

worked good for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: liver tissue
FH

Balawant (Verified Customer) (07-25-2022)

this is very excellent antibody, I have used and it is working great. I will recumbent this antibody if you want for immunoblotting.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: Colon tissue and renal cell line
FH

Susmita (Verified Customer) (04-13-2022)

This antibody is working fine for my WB

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 1500
  • Cell Tissue Type: CRC cell line
FH

Iram (Verified Customer) (09-17-2020)

HMGA2 bands are very clear and sharp bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000 for western
  • Cell Tissue Type: Human colon cancer
Loading...
||
New chat

Able

正在加载,请稍候...