Tested Applications
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-20795 targets HMGA2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14588 Product name: Recombinant human HMGA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of NM_003483 Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED Predict reactive species |
| Full Name | high mobility group AT-hook 2 |
| Calculated Molecular Weight | 108 aa, 12 kDa |
| Observed Molecular Weight | 18-20 kDa |
| GenBank Accession Number | NM_003483 |
| Gene Symbol | HMGA2 |
| Gene ID (NCBI) | 8091 |
| RRID | AB_3084041 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52926 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HMGA2 belongs to the family of high mobility group with AT-hook DNA binding domain. HMGA proteins are considered architectural transcription factors; they do not have direct transcriptional activation capacity, but instead regulate gene expression by changing DNA conformation through binding to AT-rich regions in the DNA and/or direct interaction with other transcription factors (PMID: 18202751,19551524). HMGA2 is abundantly and ubiquitously expressed and plays a crucial role during embryonic development (18425117). HMGA2 promotes stem cell self-renewal and research studies have shown that decreased HMGA2 expression is associated with stem cell aging (19551524). Investigators have shown that expression levels of HMGA2 are very low in normal adult tissues, while either overexpression or rearrangement is associated with many types of cancer (PMID: 20228781). The calcualted molecular weight of HMGA2 is 12 kDa, but modified HMGA2 is about 18-20 kDa. (PMID: 18505920 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 HMGA2 antibody CL488-20795 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

