HNRPLL Polyclonal antibody

• 

  WB analysis using 26769-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26769-1-AP (HNRPLL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26769-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26769-1-AP (HNRPLL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 26769-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26769-1-AP (HNRPLL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 26769-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26769-1-AP (HNRPLL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 26769-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26769-1-AP (HNRPLL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26769-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26769-1-AP (HNRPLL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26769-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HNRPLL antibody (26769-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

HNRPLL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26769-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, RIP, ELISA

Synonyms

Stromal RNA-regulating factor, SRRF, hnRNPLL, Heterogeneous nuclear ribonucleoprotein L-like

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells
• Positive IHC detected in: mouse kidney tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• RIP: See 1 publications below

Product Information

26769-1-AP targets HNRPLL in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25287

  Product name: Recombinant human HNRPLL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC017480

  Sequence: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH

• Full Name: heterogeneous nuclear ribonucleoprotein L-like
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC017480
• Gene Symbol: HNRPLL
• Gene ID (NCBI): 92906
• RRID: AB_2880628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVV9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNRPLL, also named as HNRNPLL and SRRF, is an RNA binding protein that regulates alternative splicing of pre-mRNA. HnRNPLL is up-regulated in stimulated T cells, bound CD45 transcripts, and is a key inducible regulator of CD45 alternative splicing (PMID: 18669861). HNRPLL has 5 isoforms with the molecular weights of 31-60 kDa. Additionally, studies have shown that HNRPLL is a metastasis suppressor gene in colorectal cancer (PMID: 28360095).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Stem Cell Rev Rep; Lnc-PPP2R1B Mediates the Alternative Splicing of PPP2R1B by Interacting and Stabilizing HNRNPLL and Promotes Osteogenesis of MSCs; Authors - Shuping Peng
human	WB,IHC,IF	J Exp Clin Cancer Res; Energy stress-induced circZFR enhances oxidative phosphorylation in lung adenocarcinoma via regulating alternative splicing; Authors - Zhifei Ma ; KD Validated
human	RIP,IHC	Cancer Lett; hnRNPLL regulates MYOF alternative splicing and correlates with early metastasis in pancreatic ductal adenocarcinoma; Authors - Xianghan Chen ; KD Validated