Tested Applications
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-26769 targets HNRPLL in IF/ICC applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25287 Product name: Recombinant human HNRPLL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC017480 Sequence: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH Predict reactive species |
Full Name | heterogeneous nuclear ribonucleoprotein L-like |
Observed Molecular Weight | 60 kDa |
GenBank Accession Number | BC017480 |
Gene Symbol | HNRPLL |
Gene ID (NCBI) | 92906 |
RRID | AB_3672804 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WVV9 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HNRPLL, also named as HNRNPLL and SRRF, is an RNA binding protein that regulates alternative splicing of pre-mRNA. HnRNPLL is up-regulated in stimulated T cells, bound CD45 transcripts, and is a key inducible regulator of CD45 alternative splicing (PMID: 18669861). HNRPLL has 5 isoforms with the molecular weights of 31-60 kDa. Additionally, studies have shown that HNRPLL is a metastasis suppressor gene in colorectal cancer (PMID: 28360095).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 HNRPLL antibody CL488-26769 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |