• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HOXA7 Monoclonal antibody

HOXA7 Monoclonal Antibody for IF/ICC
Cat No. CL488-67112
Clone No.2A7H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

HOX1.1, HOX1, Homeobox protein Hox-A7, Homeobox protein Hox-1A, ANTP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67112 targets HOXA7 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19025

Product name: Recombinant human HOXA7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-110 aa of BC148692

Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH

Predict reactive species
Full Name homeobox A7
Calculated Molecular Weight 230 aa, 25 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC148692
Gene Symbol HOXA7
Gene ID (NCBI) 3204
RRIDAB_2919422
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31268
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HOXA7 antibody CL488-67112Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...