HOXA7 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• HOXA7 Monoclonal antibody (67112-1-Ig)

• Featured Product
• KD/KO Validated

HOXA7 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67112-1-Ig Copied!

Clone No. 2A7H6

Publications (5)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2A7H6, ANTP, Homeobox protein Hox-1A, Homeobox protein Hox-A7, HOX1

• 

  WB analysis using 67112-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67112-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of THP-1 using 67112-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 67112-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 67112-1-Ig

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-29 using 67112-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 67112-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 67112-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67112-1-Ig (HOXA7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67112-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67112-1-Ig (HOXA7 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HOXA7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HCT 116 cells, HepG2 cells, HL-60 cells, HT-29 cells, K-562 cells, SMMC-7721 cells, THP-1 cells, ACHN cells, SiHa cells, NCI-H1299 cells, HEK-293 cells, RKO cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67112-1-Ig targets HOXA7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19025

  Product name: Recombinant human HOXA7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-110 aa of BC148692

  Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH

• Full Name: homeobox A7
• Calculated Molecular Weight: 230 aa, 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC148692
• Gene Symbol: HOXA7
• Gene ID (NCBI): 3204
• RRID: AB_2882416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P31268
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta.

Publications

What published studies show

Anti-HOXA7 (Cat# 67112-1-Ig) has 5 citations published in Cell Reports, Cancer Science, Journal of Orthopaedic Surgery and Research, Placenta, and Reproductive Sciences. Research fields span neural development and axon regeneration, esophageal squamous cell carcinoma, osteogenic differentiation of bone mesenchymal stem cells, placental trophoblast biology in gestational diabetes, and trophoblast cell proliferation and migration.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Rep; A human corticospinal organoid-slice connectoid model informs enhancer strategies for post-injury axon regrowth.; Authors - George M. Gibbons
mouse,human	WB,IHC,IF	Cancer Sci; Homeobox A7 promotes esophageal squamous cell carcinoma progression through C-C motif chemokine ligand 2-mediated tumor-associated macrophage recruitment; Authors - Anqi Feng ; KD Validated
human	WB	J Orthop Surg Res; MiR-920 promotes osteogenic differentiation of human bone mesenchymal stem cells by targeting HOXA7.; Authors - Jun-Pu Zha
human	WB	Placenta; miR-196a-5p suppresses the MAPK/ERK pathway by targeting HOXA7 to regulate the proliferation and apoptosis of placental trophoblasts in gestational diabetes.; Authors - Jianhua Li
human	WB	Reprod Sci; CircPAPPA Regulates the Proliferation, Migration, Invasion, Apoptosis, and Cell Cycle of Trophoblast Cells Through the miR-3127-5p/HOXA7 Axis.; Authors - Jun Li