• Featured Product
  • KD/KO Validated

HOXA7 Monoclonal antibody

HOXA7 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 67112-1-Ig
Clone No.2A7H6

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

2A7H6, ANTP, Homeobox protein Hox-1A, Homeobox protein Hox-A7, HOX1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HCT 116 cells, HepG2 cells, HL-60 cells, HT-29 cells, K-562 cells, SMMC-7721 cells, THP-1 cells, ACHN cells, SiHa cells, NCI-H1299 cells, HEK-293 cells, RKO cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67112-1-Ig targets HOXA7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19025

Product name: Recombinant human HOXA7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-110 aa of BC148692

Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH

Predict reactive species
Full Name homeobox A7
Calculated Molecular Weight 230 aa, 25 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC148692
Gene Symbol HOXA7
Gene ID (NCBI) 3204
RRIDAB_2882416
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31268
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta.

Protocols

Product Specific Protocols
IF protocol for HOXA7 antibody 67112-1-IgDownload protocol
WB protocol for HOXA7 antibody 67112-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Reprod Sci

CircPAPPA Regulates the Proliferation, Migration, Invasion, Apoptosis, and Cell Cycle of Trophoblast Cells Through the miR-3127-5p/HOXA7 Axis.

Authors - Jun Li
humanWB

J Orthop Surg Res

MiR-920 promotes osteogenic differentiation of human bone mesenchymal stem cells by targeting HOXA7.

Authors - Jun-Pu Zha
mouse,humanWB,IHC,IF

Cancer Sci

Homeobox A7 promotes esophageal squamous cell carcinoma progression through C-C motif chemokine ligand 2-mediated tumor-associated macrophage recruitment

Authors - Anqi Feng
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...