Tested Applications
Positive WB detected in | C6 cells, HEK-293 cells, mouse testis tissue, NIH/3T3 cells, mouse brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells, HepG2 cells |
Positive FC (Intra) detected in | C6 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
ELISA | See 1 publications below |
Product Information
21206-1-AP targets HSPA4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
Tested Reactivity | human, mouse, rat, monkey |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15581 Product name: Recombinant human HSPA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 680-840 aa of BC110861 Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID Predict reactive species |
Full Name | heat shock 70kDa protein 4 |
Calculated Molecular Weight | 840 aa, 94 kDa |
Observed Molecular Weight | 110 kDa |
GenBank Accession Number | BC110861 |
Gene Symbol | HSPA4 |
Gene ID (NCBI) | 3308 |
RRID | AB_10733641 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P34932 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (HSP110) subfamily of HSP70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors. This antibody well recognized the endogenous HSPA4 protein in mouse brain/ testis tissues. (PMID: 21487003)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HSPA4 antibody 21206-1-AP | Download protocol |
IHC protocol for HSPA4 antibody 21206-1-AP | Download protocol |
IF protocol for HSPA4 antibody 21206-1-AP | Download protocol |
IP protocol for HSPA4 antibody 21206-1-AP | Download protocol |
FC protocol for HSPA4 antibody 21206-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci Comparative Hypothalamic Proteomic Analysis Between Diet-Induced Obesity and Diet-Resistant Rats | ||
Int J Biochem Cell Biol Folate deprivation induces cell cycle arrest at G0/G1 phase and apoptosis in hippocampal neuron cells through down-regulation of IGF-1 signaling pathway. | ||
Int J Mol Sci Quantitative Proteomic Analysis of Escherichia coli Heat-Labile Toxin B Subunit (LTB) with Enterovirus 71 (EV71) Subunit VP1. | ||
Int J Med Sci Exercise combined with trimetazidine improves anti-fatal stress capacity through enhancing autophagy and heat shock protein 70 of myocardium in mice. | ||
Mol Cell Proteomics A new cellular interactome of SARS-CoV-2 nucleocapsid protein and its biological implications |