Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | human brain tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
26408-1-AP targets HTR2B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24007 Product name: Recombinant human HTR2B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-56 aa of BC063123 Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 2B |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC063123 |
| Gene Symbol | HTR2B |
| Gene ID (NCBI) | 3357 |
| RRID | AB_2880503 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41595 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The serotonin (5-HT) gene has been implicated in the development of personality traits or temperament predisposition. HTR2B(serotonin receptor 2B) has been shown that 3,4-methylene-dioxymethamphetamine, commonly referred to as the drug ecstasy, selectively binds and activates 5-HT2B receptors to induce serotonin release in mouse raphe nuclei, which leads to dopamine release in the nucleus accumbens and ventral tegmentum (PMID:23774082). Moreover, One of the most reliable predictive markers of UM (Uveal melanoma) at risk of evolving toward the formation of liver lesions is an abnormally elevated level of expression of the transcript encoding the HTR2B (PMID:31002821).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HTR2B antibody 26408-1-AP | Download protocol |
| WB protocol for HTR2B antibody 26408-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Hypertension Subtypes of Histopathologically Classical Aldosterone-Producing Adenomas Yield Various Transcriptomic Signaling and Outcomes. | ||
Mol Cancer Res Serotonin receptor HTR2B facilitates colorectal cancer metastasis via CREB1-ZEB1 axis mediated epithelial-mesenchymal transition | ||
J Mol Neurosci Effects of Electroacupuncture at Varied Frequencies on Analgesia and Mechanisms in Sciatic Nerve Cuffing-Induced Neuropathic Pain Mice | ||
Biochim Biophys Acta Mol Basis Dis FTO-mediated RNA m6A methylation regulates synovial aggression and inflammation in rheumatoid arthritis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Anna (Verified Customer) (10-04-2022) | Large background, no specific reaction. I have a problem with attaching a photo file. Please check the file below. https://drive.google.com/file/d/15d3t6thx7rcWyN-_DkkKCtpAMyi8jxHO/view
|









