Tested Applications
| Positive WB detected in | rat heart tissue, HEK-293 cells |
| Positive IHC detected in | human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21165-1-AP targets HTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15226 Product name: Recombinant human HTR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-388 aa of BC074755 Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 4 |
| Calculated Molecular Weight | 388 aa, 44 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC074755 |
| Gene Symbol | HTR4 |
| Gene ID (NCBI) | 3360 |
| RRID | AB_11182374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13639 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HTR4 (5-hydroxytryptamine receptor 4, 5-HT4) is a G protein-coupled receptor (GPCR) belonging to the serotonin receptor family. HTR4 is widely expressed in the gastrointestinal tract, central nervous system, and cardiovascular system, where it regulates gastrointestinal motility, neurotransmission, learning and memory, and cardiac function. The neurotransmitter 5-HT is mainly secreted by enterochromaffin (EC) cells, and its extracellular levels are regulated by the sodium-dependent serotonin transporter solute carrier family 6 member 4 (SLC6A4). EC cells are neurosensory cells located in the intestinal epithelium that convert the perceived intestinal environmental signals into 5-HT secretion, thereby contributing to intestinal motility. (PMID: 40605973)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HTR4 antibody 21165-1-AP | Download protocol |
| IHC protocol for HTR4 antibody 21165-1-AP | Download protocol |
| WB protocol for HTR4 antibody 21165-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-HTR4 antibody (Cat# 21165-1-AP) has 16 citations. These appear in journals including Int J Biol Sci, Phytomedicine, Biomed Pharmacother, Brain Behav Immun, Food Res Int, Int J Biol Macromol, Front Microbiol, J Dairy Sci, J Nutr, Nutrients, Pharm Biol, Foods, Naunyn Schmiedebergs Arch Pharmacol, Biochem Biophys Res Commun, and J Agric Food Chem. Research fields span gut microbiota, constipation, serotonin (5-HT) signaling, intestinal barrier function, IBS, colitis, and anxiety.
| Species | Application | Title |
|---|---|---|
Int J Biol Sci Chronic Stress-induced Serotonin Impairs Intestinal Epithelial Cell Mitochondrial Biogenesis via the AMPK-PGC-1α Axis | ||
Phytomedicine Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis | ||
Food Res Int Polysaccharide from Aloe vera gel improves intestinal stem cells dysfunction to alleviate intestinal barrier damage via 5-HT | ||
Int J Biol Macromol Hyaluronic acid-ethylenediamine-cinnamic acid attenuates IBS-D via regulating 5-hydroxytryptamine signaling pathway, intestinal barrier and gut microbiota. | ||
Biomed Pharmacother L-NRB alleviates amyotrophic lateral sclerosis by regulating P11-Htr4 signaling pathway | ||
Brain Behav Immun Long-term antibiotics treatment-induced anxiety-like behavior is associated with disrupted colonic tryptophan metabolism. |
