Tested Applications
| Positive IHC detected in | human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
21165-1-AP targets HTR4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15226 Product name: Recombinant human HTR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-388 aa of BC074755 Sequence: GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT Predict reactive species |
| Full Name | 5-hydroxytryptamine (serotonin) receptor 4 |
| Calculated Molecular Weight | 388 aa, 44 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC074755 |
| Gene Symbol | HTR4 |
| Gene ID (NCBI) | 3360 |
| RRID | AB_11182374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13639 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HTR4 antibody 21165-1-AP | Download protocol |
| IHC protocol for HTR4 antibody 21165-1-AP | Download protocol |
| WB protocol for HTR4 antibody 21165-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis | ||
Biomed Pharmacother Enteromorpha and polysaccharides from enteromorpha ameliorate loperamide-induced constipation in mice. | ||
Nutrients Living, Heat-Killed Limosilactobacillus mucosae and Its Cell-Free Supernatant Differentially Regulate Colonic Serotonin Receptors and Immune Response in Experimental Colitis | ||
J Dairy Sci Synbiotic yogurt containing konjac mannan oligosaccharides and Bifidobacterium animalis ssp. lactis BB12 alleviates constipation in mice by modulating the stem cell factor (SCF)/c-Kit pathway and gut microbiota. | ||
Biomed Pharmacother L-NRB alleviates amyotrophic lateral sclerosis by regulating P11-Htr4 signaling pathway |







